Anti SLC25A15 pAb (ATL-HPA042146)

Atlas Antibodies

SKU: ATL-HPA042146-25

• 

Protein Description: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Gene Name: SLC25A15
Alternative Gene Name: D13S327, HHH, ORC1, ORNT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031482: 93%, ENSRNOG00000011881: 93%
Entrez Gene ID: 10166
Uniprot ID: Q9Y619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTACVLTGQPFDTIKVKMQTFPDLYKGLTD
• Gene Sequence: GTACVLTGQPFDTIKVKMQTFPDLYKGLTD
• Gene ID - Mouse: ENSMUSG00000031482
• Gene ID - Rat: ENSRNOG00000011881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.