Anti SKA3 pAb (ATL-HPA061534)

Atlas Antibodies

Catalog No.:
ATL-HPA061534-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: spindle and kinetochore associated complex subunit 3
Gene Name: SKA3
Alternative Gene Name: C13orf3, MGC4832, RAMA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021965: 45%, ENSRNOG00000021847: 58%
Entrez Gene ID: 221150
Uniprot ID: Q8IX90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN
Gene Sequence RTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN
Gene ID - Mouse ENSMUSG00000021965
Gene ID - Rat ENSRNOG00000021847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SKA3 pAb (ATL-HPA061534)
Datasheet Anti SKA3 pAb (ATL-HPA061534) Datasheet (External Link)
Vendor Page Anti SKA3 pAb (ATL-HPA061534) at Atlas Antibodies

Documents & Links for Anti SKA3 pAb (ATL-HPA061534)
Datasheet Anti SKA3 pAb (ATL-HPA061534) Datasheet (External Link)
Vendor Page Anti SKA3 pAb (ATL-HPA061534)