Anti SDHA pAb (ATL-HPA064582 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA064582-25

• 
• 

Protein Description: succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
Gene Name: SDHA
Alternative Gene Name: FP, SDH2, SDHF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021577: 94%, ENSRNOG00000013331: 96%
Entrez Gene ID: 6389
Uniprot ID: P31040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEES
• Gene Sequence: VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEES
• Gene ID - Mouse: ENSMUSG00000021577
• Gene ID - Rat: ENSRNOG00000013331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.