Anti SCD5 pAb (ATL-HPA042380)

Atlas Antibodies

SKU:
ATL-HPA042380-25
  • Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: stearoyl-CoA desaturase 5
Gene Name: SCD5
Alternative Gene Name: ACOD4, FADS4, FLJ21032, HSCD5, SCD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022441: 24%, ENSRNOG00000032206: 23%
Entrez Gene ID: 79966
Uniprot ID: Q86SK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTQHIQKEGRALNQEAACEMLREWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF
Gene Sequence NTQHIQKEGRALNQEAACEMLREWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF
Gene ID - Mouse ENSMUSG00000022441
Gene ID - Rat ENSRNOG00000032206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCD5 pAb (ATL-HPA042380)
Datasheet Anti SCD5 pAb (ATL-HPA042380) Datasheet (External Link)
Vendor Page Anti SCD5 pAb (ATL-HPA042380) at Atlas Antibodies

Documents & Links for Anti SCD5 pAb (ATL-HPA042380)
Datasheet Anti SCD5 pAb (ATL-HPA042380) Datasheet (External Link)
Vendor Page Anti SCD5 pAb (ATL-HPA042380)