Anti RREB1 pAb (ATL-HPA001756)

Atlas Antibodies

Catalog No.: ATL-HPA001756-25

Protein Description: ras responsive element binding protein 1
Gene Name: RREB1
Alternative Gene Name: HNT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039087: 86%, ENSRNOG00000015701: 83%
Entrez Gene ID: 6239
Uniprot ID: Q92766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATTDTNKFSPFLQTAEDNTQDEVAGAPADHHGPSDEEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVFPWASSLQRHMLTHTGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTIRRAPPLSNN
• Gene Sequence: ATTDTNKFSPFLQTAEDNTQDEVAGAPADHHGPSDEEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVFPWASSLQRHMLTHTGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTIRRAPPLSNN
• Gene ID - Mouse: ENSMUSG00000039087
• Gene ID - Rat: ENSRNOG00000015701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RREB1 pAb (ATL-HPA001756) – 2 Found

Nitz, Matthew D; Harding, Michael A; Smith, Steven C; Thomas, Shibu; Theodorescu, Dan. RREB1 transcription factor splice variants in urologic cancer. The American Journal Of Pathology. 2011;179(1):477-86. 

Mattis, Katia K; Krentz, Nicole A J; Metzendorf, Christoph; Abaitua, Fernando; Spigelman, Aliya F; Sun, Han; Ikle, Jennifer M; Thaman, Swaraj; Rottner, Antje K; Bautista, Austin; Mazzaferro, Eugenia; Perez-Alcantara, Marta; Manning Fox, Jocelyn E; Torres, Jason M; Wesolowska-Andersen, Agata; Yu, Grace Z; Mahajan, Anubha; Larsson, Anders; MacDonald, Patrick E; Davies, Benjamin; den Hoed, Marcel; Gloyn, Anna L. Loss of RREB1 in pancreatic beta cells reduces cellular insulin content and affects endocrine cell gene expression. Diabetologia. 2023;66(4):674-694.