Anti RNF208 pAb (ATL-HPA021429)

Atlas Antibodies

SKU:
ATL-HPA021429-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in a subset of cortical cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ring finger protein 208
Gene Name: RNF208
Alternative Gene Name: DKFZP761H1710
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044628: 96%, ENSRNOG00000010607: 96%
Entrez Gene ID: 727800
Uniprot ID: Q9H0X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLS
Gene Sequence YESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLS
Gene ID - Mouse ENSMUSG00000044628
Gene ID - Rat ENSRNOG00000010607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF208 pAb (ATL-HPA021429)
Datasheet Anti RNF208 pAb (ATL-HPA021429) Datasheet (External Link)
Vendor Page Anti RNF208 pAb (ATL-HPA021429) at Atlas Antibodies

Documents & Links for Anti RNF208 pAb (ATL-HPA021429)
Datasheet Anti RNF208 pAb (ATL-HPA021429) Datasheet (External Link)
Vendor Page Anti RNF208 pAb (ATL-HPA021429)