Anti RND1 pAb (ATL-HPA077800)
Atlas Antibodies
- SKU:
- ATL-HPA077800-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RND1
Alternative Gene Name: ARHS, Rho6, RHOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054855: 98%, ENSRNOG00000059857: 98%
Entrez Gene ID: 27289
Uniprot ID: Q92730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSI |
Gene Sequence | TDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSI |
Gene ID - Mouse | ENSMUSG00000054855 |
Gene ID - Rat | ENSRNOG00000059857 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RND1 pAb (ATL-HPA077800) | |
Datasheet | Anti RND1 pAb (ATL-HPA077800) Datasheet (External Link) |
Vendor Page | Anti RND1 pAb (ATL-HPA077800) at Atlas Antibodies |
Documents & Links for Anti RND1 pAb (ATL-HPA077800) | |
Datasheet | Anti RND1 pAb (ATL-HPA077800) Datasheet (External Link) |
Vendor Page | Anti RND1 pAb (ATL-HPA077800) |
Citations for Anti RND1 pAb (ATL-HPA077800) – 1 Found |
Kumar, Akhilesh; Mishra, Shalabh; Kumar, Ashish; Raut, Ashwin Ashok; Sato, Seiichi; Takaoka, Akinori; Kumar, Himanshu. Essential role of Rnd1 in innate immunity during viral and bacterial infections. Cell Death & Disease. 2022;13(6):520. PubMed |