Anti RHPN2 pAb (ATL-HPA051749)

Atlas Antibodies

Catalog No.:
ATL-HPA051749-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: rhophilin, Rho GTPase binding protein 2
Gene Name: RHPN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030494: 70%, ENSRNOG00000011885: 71%
Entrez Gene ID: 85415
Uniprot ID: Q8IUC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL
Gene Sequence DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL
Gene ID - Mouse ENSMUSG00000030494
Gene ID - Rat ENSRNOG00000011885
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHPN2 pAb (ATL-HPA051749)
Datasheet Anti RHPN2 pAb (ATL-HPA051749) Datasheet (External Link)
Vendor Page Anti RHPN2 pAb (ATL-HPA051749) at Atlas Antibodies

Documents & Links for Anti RHPN2 pAb (ATL-HPA051749)
Datasheet Anti RHPN2 pAb (ATL-HPA051749) Datasheet (External Link)
Vendor Page Anti RHPN2 pAb (ATL-HPA051749)