Anti RANBP2 pAb (ATL-HPA067564)

Atlas Antibodies

Catalog No.:
ATL-HPA067564-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: RAN binding protein 2
Gene Name: RANBP2
Alternative Gene Name: ADANE, ANE1, NUP358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003226: 100%, ENSRNOG00000000796: 100%
Entrez Gene ID: 5903
Uniprot ID: P49792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK
Gene Sequence LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK
Gene ID - Mouse ENSMUSG00000003226
Gene ID - Rat ENSRNOG00000000796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RANBP2 pAb (ATL-HPA067564)
Datasheet Anti RANBP2 pAb (ATL-HPA067564) Datasheet (External Link)
Vendor Page Anti RANBP2 pAb (ATL-HPA067564) at Atlas Antibodies

Documents & Links for Anti RANBP2 pAb (ATL-HPA067564)
Datasheet Anti RANBP2 pAb (ATL-HPA067564) Datasheet (External Link)
Vendor Page Anti RANBP2 pAb (ATL-HPA067564)