Anti PPP2R3C pAb (ATL-HPA058834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058834-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PPP2R3C
Alternative Gene Name: C14orf10, FLJ20644, G4-1, G5PR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021022: 96%, ENSRNOG00000023591: 95%
Entrez Gene ID: 55012
Uniprot ID: Q969Q6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF |
Gene Sequence | LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF |
Gene ID - Mouse | ENSMUSG00000021022 |
Gene ID - Rat | ENSRNOG00000023591 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPP2R3C pAb (ATL-HPA058834) | |
Datasheet | Anti PPP2R3C pAb (ATL-HPA058834) Datasheet (External Link) |
Vendor Page | Anti PPP2R3C pAb (ATL-HPA058834) at Atlas Antibodies |
Documents & Links for Anti PPP2R3C pAb (ATL-HPA058834) | |
Datasheet | Anti PPP2R3C pAb (ATL-HPA058834) Datasheet (External Link) |
Vendor Page | Anti PPP2R3C pAb (ATL-HPA058834) |