Anti POSTN pAb (ATL-HPA012306 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA012306-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: POSTN
Alternative Gene Name: OSF-2, periostin, PN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027750: 95%, ENSRNOG00000012660: 95%
Entrez Gene ID: 10631
Uniprot ID: Q15063
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG |
Gene Sequence | GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG |
Gene ID - Mouse | ENSMUSG00000027750 |
Gene ID - Rat | ENSRNOG00000012660 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) | |
Datasheet | Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) | |
Datasheet | Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) |
Citations for Anti POSTN pAb (ATL-HPA012306 w/enhanced validation) – 10 Found |
Wang, Zheyu; Luan, Jingyi; Seth, Anushree; Liu, Lin; You, Minli; Gupta, Prashant; Rathi, Priya; Wang, Yixuan; Cao, Sisi; Jiang, Qisheng; Zhang, Xiao; Gupta, Rohit; Zhou, Qingjun; Morrissey, Jeremiah J; Scheller, Erica L; Rudra, Jai S; Singamaneni, Srikanth. Microneedle patch for the ultrasensitive quantification of protein biomarkers in interstitial fluid. Nature Biomedical Engineering. 2021;5(1):64-76. PubMed |
Gillot, Lionel; Lebeau, Alizée; Baudin, Louis; Pottier, Charles; Louis, Thomas; Durré, Tania; Longuespée, Rémi; Mazzucchelli, Gabriel; Nizet, Christophe; Blacher, Silvia; Kridelka, Frédéric; Noël, Agnès. Periostin in lymph node pre-metastatic niches governs lymphatic endothelial cell functions and metastatic colonization. Cellular And Molecular Life Sciences : Cmls. 2022;79(6):295. PubMed |
Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73. PubMed |
Attur, Mukundan; Yang, Qing; Shimada, Kohei; Tachida, Yuki; Nagase, Hiroyuki; Mignatti, Paolo; Statman, Lauren; Palmer, Glyn; Kirsch, Thorsten; Beier, Frank; Abramson, Steven B. Elevated expression of periostin in human osteoarthritic cartilage and its potential role in matrix degradation via matrix metalloproteinase-13. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2015;29(10):4107-21. PubMed |
Oh, Hyeon Jeong; Bae, Jeong Mo; Wen, Xian-Yu; Cho, Nam-Yun; Kim, Jung Ho; Kang, Gyeong Hoon. Overexpression of POSTN in Tumor Stroma Is a Poor Prognostic Indicator of Colorectal Cancer. Journal Of Pathology And Translational Medicine. 2017;51(3):306-313. PubMed |
Zhang, Teming; Han, Zheng; Chandoo, Arvine; Huang, Xincheng; Sun, Xiangwei; Ye, Lele; Hu, Changyuan; Xue, Xiangyang; Huang, Yingpeng; Shen, Xian; Chang, Wenjun; Lin, Xiaoming. Low periostin expression predicts poor survival in intestinal type gastric cancer patients. Cancer Management And Research. 11( 30588108):25-36. PubMed |
Paunas, Flavia Teodora Ioana; Finne, Kenneth; Leh, Sabine; Osman, Tarig Al-Hadi; Marti, Hans-Peter; Berven, Frode; Vikse, Bjørn Egil. Characterization of glomerular extracellular matrix in IgA nephropathy by proteomic analysis of laser-captured microdissected glomeruli. Bmc Nephrology. 2019;20(1):410. PubMed |
Boehm, Mario; Tian, Xuefei; Mao, Yuqiang; Ichimura, Kenzo; Dufva, Melanie J; Ali, Khadem; Dannewitz Prosseda, Svenja; Shi, Yiwei; Kuramoto, Kazuya; Reddy, Sushma; Kheyfets, Vitaly O; Metzger, Ross J; Spiekerkoetter, Edda. Delineating the molecular and histological events that govern right ventricular recovery using a novel mouse model of pulmonary artery de-banding. Cardiovascular Research. 2020;116(10):1700-1709. PubMed |
Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481. PubMed |
Paunas, Flavia Teodora Ioana; Finne, Kenneth; Leh, Sabine; Marti, Hans-Peter; Berven, Frode; Vikse, Bjørn Egil. Proteomic signature of tubulointerstitial tissue predicts prognosis in IgAN. Bmc Nephrology. 2022;23(1):118. PubMed |