Anti POLR3C pAb (ATL-HPA027516 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027516-25

Protein Description: polymerase (RNA) III (DNA directed) polypeptide C (62kD)
Gene Name: POLR3C
Alternative Gene Name: RPC3, RPC62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028099: 95%, ENSRNOG00000033560: 95%
Entrez Gene ID: 10623
Uniprot ID: Q9BUI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRTFYLYTVNILSAARM
• Gene Sequence: VINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRTFYLYTVNILSAARM
• Gene ID - Mouse: ENSMUSG00000028099
• Gene ID - Rat: ENSRNOG00000033560
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POLR3C pAb (ATL-HPA027516 w/enhanced validation) – 1 Found

Ogunjimi, Benson; Zhang, Shen-Ying; Sørensen, Katrine B; Skipper, Kristian A; Carter-Timofte, Madalina; Kerner, Gaspard; Luecke, Stefanie; Prabakaran, Thaneas; Cai, Yujia; Meester, Josephina; Bartholomeus, Esther; Bolar, Nikhita Ajit; Vandeweyer, Geert; Claes, Charlotte; Sillis, Yasmine; Lorenzo, Lazaro; Fiorenza, Raffaele A; Boucherit, Soraya; Dielman, Charlotte; Heynderickx, Steven; Elias, George; Kurotova, Andrea; Auwera, Ann Vander; Verstraete, Lieve; Lagae, Lieven; Verhelst, Helene; Jansen, Anna; Ramet, Jose; Suls, Arvid; Smits, Evelien; Ceulemans, Berten; Van Laer, Lut; Plat Wilson, Genevieve; Kreth, Jonas; Picard, Capucine; Von Bernuth, Horst; Fluss, Joël; Chabrier, Stephane; Abel, Laurent; Mortier, Geert; Fribourg, Sebastien; Mikkelsen, Jacob Giehm; Casanova, Jean-Laurent; Paludan, Søren R; Mogensen, Trine H. Inborn errors in RNA polymerase III underlie severe varicella zoster virus infections. The Journal Of Clinical Investigation. 2017;127(9):3543-3556.