Anti PLA1A pAb (ATL-HPA059740)

Atlas Antibodies

Catalog No.:
ATL-HPA059740-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phospholipase A1 member A
Gene Name: PLA1A
Alternative Gene Name: ps-PLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002847: 71%, ENSRNOG00000057153: 68%
Entrez Gene ID: 51365
Uniprot ID: Q53H76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC
Gene Sequence QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC
Gene ID - Mouse ENSMUSG00000002847
Gene ID - Rat ENSRNOG00000057153
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLA1A pAb (ATL-HPA059740)
Datasheet Anti PLA1A pAb (ATL-HPA059740) Datasheet (External Link)
Vendor Page Anti PLA1A pAb (ATL-HPA059740) at Atlas Antibodies

Documents & Links for Anti PLA1A pAb (ATL-HPA059740)
Datasheet Anti PLA1A pAb (ATL-HPA059740) Datasheet (External Link)
Vendor Page Anti PLA1A pAb (ATL-HPA059740)