Anti PLA1A pAb (ATL-HPA059740)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059740-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PLA1A
Alternative Gene Name: ps-PLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002847: 71%, ENSRNOG00000057153: 68%
Entrez Gene ID: 51365
Uniprot ID: Q53H76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC |
Gene Sequence | QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC |
Gene ID - Mouse | ENSMUSG00000002847 |
Gene ID - Rat | ENSRNOG00000057153 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLA1A pAb (ATL-HPA059740) | |
Datasheet | Anti PLA1A pAb (ATL-HPA059740) Datasheet (External Link) |
Vendor Page | Anti PLA1A pAb (ATL-HPA059740) at Atlas Antibodies |
Documents & Links for Anti PLA1A pAb (ATL-HPA059740) | |
Datasheet | Anti PLA1A pAb (ATL-HPA059740) Datasheet (External Link) |
Vendor Page | Anti PLA1A pAb (ATL-HPA059740) |