Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045702-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: peptidoglycan recognition protein 1
Gene Name: PGLYRP1
Alternative Gene Name: PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030413: 71%, ENSRNOG00000013395: 68%
Entrez Gene ID: 8993
Uniprot ID: O75594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN
Gene Sequence PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN
Gene ID - Mouse ENSMUSG00000030413
Gene ID - Rat ENSRNOG00000013395
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation)
Datasheet Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation)
Datasheet Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation)