Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031711-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PERM1
Alternative Gene Name: C1orf170, MGC13275, Perm1, RP11-54O7.8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078486: 61%, ENSRNOG00000020244: 62%
Entrez Gene ID: 84808
Uniprot ID: Q5SV97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE |
Gene Sequence | ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE |
Gene ID - Mouse | ENSMUSG00000078486 |
Gene ID - Rat | ENSRNOG00000020244 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) | |
Datasheet | Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) | |
Datasheet | Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) |
Citations for Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) – 5 Found |
Cho, Yoshitake; Tachibana, Shizuko; Hazen, Bethany C; Moresco, James J; Yates, John R 3rd; Kok, Bernard; Saez, Enrique; Ross, Robert S; Russell, Aaron P; Kralli, Anastasia. Perm1 regulates CaMKII activation and shapes skeletal muscle responses to endurance exercise training. Molecular Metabolism. 2019;23( 30862473):88-97. PubMed |
Oka, Shin-Ichi; Sabry, Amira D; Horiuchi, Amanda K; Cawley, Keiko M; O'Very, Sean A; Zaitsev, Maria A; Shankar, Thirupura S; Byun, Jaemin; Mukai, Risa; Xu, Xiaoyong; Torres, Natalia S; Kumar, Anil; Yazawa, Masayuki; Ling, Jing; Taleb, Iosif; Saijoh, Yukio; Drakos, Stavros G; Sadoshima, Junichi; Warren, Junco S. Perm1 regulates cardiac energetics as a downstream target of the histone methyltransferase Smyd1. Plos One. 15(6):e0234913. PubMed |
Müller, Sebastian; Perdikari, Aliki; Dapito, Dianne H; Sun, Wenfei; Wollscheid, Bernd; Balaz, Miroslav; Wolfrum, Christian. ESRRG and PERM1 Govern Mitochondrial Conversion in Brite/Beige Adipocyte Formation. Frontiers In Endocrinology. 11( 32595605):387. PubMed |
Bock, Theresa; Türk, Clara; Aravamudhan, Sriram; Keufgens, Lena; Bloch, Wilhelm; Rozsivalova, Dieu Hien; Romanello, Vanina; Nogara, Leonardo; Blaauw, Bert; Trifunovic, Aleksandra; Braun, Thomas; Krüger, Marcus. PERM1 interacts with the MICOS-MIB complex to connect the mitochondria and sarcolemma via ankyrin B. Nature Communications. 2021;12(1):4900. PubMed |
Huang, Chun-Yang; Oka, Shin-Ichi; Xu, Xiaoyong; Chen, Chian-Feng; Tung, Chien-Yi; Chang, Ya-Yuan; Mourad, Youssef; Vehra, Omair; Ivessa, Andreas; Yehia, Ghassan; Romanienko, Peter; Hsu, Chiao-Po; Sadoshima, Junichi. PERM1 regulates genes involved in fatty acid metabolism in the heart by interacting with PPARα and PGC-1α. Scientific Reports. 2022;12(1):14576. PubMed |