Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA014518-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: P2RY12
Alternative Gene Name: HORK3, P2Y12, SP1999
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036353: 70%, ENSRNOG00000013902: 63%
Entrez Gene ID: 64805
Uniprot ID: Q9H244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
Gene Sequence | KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
Gene ID - Mouse | ENSMUSG00000036353 |
Gene ID - Rat | ENSRNOG00000013902 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) | |
Datasheet | Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) | |
Datasheet | Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) |
Citations for Anti P2RY12 pAb (ATL-HPA014518 w/enhanced validation) – 25 Found |
Abud, Edsel M; Ramirez, Ricardo N; Martinez, Eric S; Healy, Luke M; Nguyen, Cecilia H H; Newman, Sean A; Yeromin, Andriy V; Scarfone, Vanessa M; Marsh, Samuel E; Fimbres, Cristhian; Caraway, Chad A; Fote, Gianna M; Madany, Abdullah M; Agrawal, Anshu; Kayed, Rakez; Gylys, Karen H; Cahalan, Michael D; Cummings, Brian J; Antel, Jack P; Mortazavi, Ali; Carson, Monica J; Poon, Wayne W; Blurton-Jones, Mathew. iPSC-Derived Human Microglia-like Cells to Study Neurological Diseases. Neuron. 2017;94(2):278-293.e9. PubMed |
Mildner, Alexander. Ghosts in the shell: identification of microglia in the human central nervous system by P2Y12 receptor. Neural Regeneration Research. 2017;12(4):570-571. PubMed |
Zarate, Miguel A; Rodriguez, Michelle D; Chang, Eileen I; Russell, Jordan T; Arndt, Thomas J; Richards, Elaine M; Ocasio, Beronica A; Aranda, Eva; Gordon, Elizabeth M; Yu, Kevin; Neu, Josef; Keller-Wood, Maureen; Triplett, Eric W; Wood, Charles E. Post-hypoxia Invasion of the fetal brain by multidrug resistant Staphylococcus. Scientific Reports. 2017;7(1):6458. PubMed |
McQuade, Amanda; Coburn, Morgan; Tu, Christina H; Hasselmann, Jonathan; Davtyan, Hayk; Blurton-Jones, Mathew. Development and validation of a simplified method to generate human microglia from pluripotent stem cells. Molecular Neurodegeneration. 2018;13(1):67. PubMed |
Ma, Wenxin; Silverman, Sean M; Zhao, Lian; Villasmil, Rafael; Campos, Maria M; Amaral, Juan; Wong, Wai T. Absence of TGFβ signaling in retinal microglia induces retinal degeneration and exacerbates choroidal neovascularization. Elife. 2019;8( 30666961) PubMed |
Murai, Nobuhito; Mitalipova, Maisam; Jaenisch, Rudolf. Functional analysis of CX3CR1 in human induced pluripotent stem (iPS) cell-derived microglia-like cells. The European Journal Of Neuroscience. 2020;52(7):3667-3678. PubMed |
Venturino, Alessandro; Schulz, Rouven; De Jesús-Cortés, Héctor; Maes, Margaret E; Nagy, Bálint; Reilly-Andújar, Francis; Colombo, Gloria; Cubero, Ryan John A; Schoot Uiterkamp, Florianne E; Bear, Mark F; Siegert, Sandra. Microglia enable mature perineuronal nets disassembly upon anesthetic ketamine exposure or 60-Hz light entrainment in the healthy brain. Cell Reports. 2021;36(1):109313. PubMed |
Bassil, Reina; Shields, Kenneth; Granger, Kevin; Zein, Ivan; Ng, Shirley; Chih, Ben. Improved modeling of human AD with an automated culturing platform for iPSC neurons, astrocytes and microglia. Nature Communications. 2021;12(1):5220. PubMed |
You, Yang; Muraoka, Satoshi; Jedrychowski, Mark P; Hu, Jianqiao; McQuade, Amanda K; Young-Pearse, Tracy; Aslebagh, Roshanak; Shaffer, Scott A; Gygi, Steven P; Blurton-Jones, Mathew; Poon, Wayne W; Ikezu, Tsuneya. Human neural cell type-specific extracellular vesicle proteome defines disease-related molecules associated with activated astrocytes in Alzheimer's disease brain. Journal Of Extracellular Vesicles. 2022;11(1):e12183. PubMed |
Uff, Christopher E G; Patel, Karishma; Yeung, Charming; Yip, Ping K. Advances in Visualizing Microglial Cells in Human Central Nervous System Tissue. Biomolecules. 2022;12(5) PubMed |
Walker, Douglas G; Tang, Tiffany M; Mendsaikhan, Anarmaa; Tooyama, Ikuo; Serrano, Geidy E; Sue, Lucia I; Beach, Thomas G; Lue, Lih-Fen. Patterns of Expression of Purinergic Receptor P2RY12, a Putative Marker for Non-Activated Microglia, in Aged and Alzheimer's Disease Brains. International Journal Of Molecular Sciences. 2020;21(2) PubMed |
Dumas, Anaelle A; Pomella, Nicola; Rosser, Gabriel; Guglielmi, Loredana; Vinel, Claire; Millner, Thomas O; Rees, Jeremy; Aley, Natasha; Sheer, Denise; Wei, Jun; Marisetty, Anantha; Heimberger, Amy B; Bowman, Robert L; Brandner, Sebastian; Joyce, Johanna A; Marino, Silvia. Microglia promote glioblastoma via mTOR-mediated immunosuppression of the tumour microenvironment. The Embo Journal. 2020;39(15):e103790. PubMed |
Swanson, Molly E V; Murray, Helen C; Ryan, Brigid; Faull, Richard L M; Dragunow, Mike; Curtis, Maurice A. Quantitative immunohistochemical analysis of myeloid cell marker expression in human cortex captures microglia heterogeneity with anatomical context. Scientific Reports. 2020;10(1):11693. PubMed |
Hohsfield, Lindsay A; Najafi, Allison R; Ghorbanian, Yasamine; Soni, Neelakshi; Hingco, Edna E; Kim, Sung Jin; Jue, Ayer Darling; Swarup, Vivek; Inlay, Mathew A; Green, Kim N. Effects of long-term and brain-wide colonization of peripheral bone marrow-derived myeloid cells in the CNS. Journal Of Neuroinflammation. 2020;17(1):279. PubMed |
Rai, Mohammad A; Hammonds, Jason; Pujato, Mario; Mayhew, Christopher; Roskin, Krishna; Spearman, Paul. Comparative analysis of human microglial models for studies of HIV replication and pathogenesis. Retrovirology. 2020;17(1):35. PubMed |
Akiyama, Hisashi; Jalloh, Sallieu; Park, Seonmi; Lei, Maohua; Mostoslavsky, Gustavo; Gummuluru, Suryaram. Expression of HIV-1 Intron-Containing RNA in Microglia Induces Inflammatory Responses. Journal Of Virology. 2021;95(5) PubMed |
Novikova, Gloriia; Kapoor, Manav; Tcw, Julia; Abud, Edsel M; Efthymiou, Anastasia G; Chen, Steven X; Cheng, Haoxiang; Fullard, John F; Bendl, Jaroslav; Liu, Yiyuan; Roussos, Panos; Björkegren, Johan Lm; Liu, Yunlong; Poon, Wayne W; Hao, Ke; Marcora, Edoardo; Goate, Alison M. Integration of Alzheimer's disease genetics and myeloid genomics identifies disease risk regulatory elements and genes. Nature Communications. 2021;12(1):1610. PubMed |
Bohannon, Diana G; Wang, Yueying; Reinhart, Colin H; Hattler, Julian B; Luo, Jiangtao; Okhravi, Hamid R; Zhang, Jianshui; Li, Qingsheng; Kuroda, Marcelo J; Kim, Jayoung; Kim, Woong-Ki. Perivascular macrophages in the neonatal macaque brain undergo massive necroptosis after simian immunodeficiency virus infection. Brain Pathology (Zurich, Switzerland). 2020;30(3):603-613. PubMed |
Wißfeld, Jannis; Mathews, Mona; Mossad, Omar; Picardi, Paola; Cinti, Alessandro; Redaelli, Loredana; Pradier, Laurent; Brüstle, Oliver; Neumann, Harald. Reporter cell assay for human CD33 validated by specific antibodies and human iPSC-derived microglia. Scientific Reports. 2021;11(1):13462. PubMed |
Henningfield, Caden M; Arreola, Miguel A; Soni, Neelakshi; Spangenberg, Elizabeth E; Green, Kim N. Microglia-specific ApoE knock-out does not alter Alzheimer's disease plaque pathogenesis or gene expression. Glia. 2022;70(2):287-302. PubMed |
Di Liberto, Giovanni; Egervari, Kristof; Kreutzfeldt, Mario; Schürch, Christian M; Hewer, Ekkehard; Wagner, Ingrid; Du Pasquier, Renaud; Merkler, Doron. Neurodegenerative phagocytes mediate synaptic stripping in Neuro-HIV. Brain : A Journal Of Neurology. 2022;145(8):2730-2741. PubMed |
Popova, Galina; Soliman, Sarah S; Kim, Chang N; Keefe, Matthew G; Hennick, Kelsey M; Jain, Samhita; Li, Tao; Tejera, Dario; Shin, David; Chhun, Bryant B; McGinnis, Christopher S; Speir, Matthew; Gartner, Zev J; Mehta, Shalin B; Haeussler, Maximilian; Hengen, Keith B; Ransohoff, Richard R; Piao, Xianhua; Nowakowski, Tomasz J. Human microglia states are conserved across experimental models and regulate neural stem cell responses in chimeric organoids. Cell Stem Cell. 2021;28(12):2153-2166.e6. PubMed |
Hübschmann, Verena; Korkut-Demirbaş, Medina; Siegert, Sandra. Assessing human iPSC-derived microglia identity and function by immunostaining, phagocytosis, calcium activity, and inflammation assay. Star Protocols. 2022;3(4):101866. PubMed |
Winkler, Ethan A; Kim, Chang N; Ross, Jayden M; Garcia, Joseph H; Gil, Eugene; Oh, Irene; Chen, Lindsay Q; Wu, David; Catapano, Joshua S; Raygor, Kunal; Narsinh, Kazim; Kim, Helen; Weinsheimer, Shantel; Cooke, Daniel L; Walcott, Brian P; Lawton, Michael T; Gupta, Nalin; Zlokovic, Berislav V; Chang, Edward F; Abla, Adib A; Lim, Daniel A; Nowakowski, Tomasz J. A single-cell atlas of the normal and malformed human brain vasculature. Science (New York, N.y.). 2022;375(6584):eabi7377. PubMed |
Johnson, Noah R; Yuan, Peng; Castillo, Erika; Lopez, T Peter; Yue, Weizhou; Bond, Annalise; Rivera, Brianna M; Sullivan, Miranda C; Hirouchi, Masakazu; Giles, Kurt; Aoyagi, Atsushi; Condello, Carlo. CSF1R inhibitors induce a sex-specific resilient microglial phenotype and functional rescue in a tauopathy mouse model. Nature Communications. 2023;14(1):118. PubMed |