Anti NOS1 pAb (ATL-HPA069509)

Atlas Antibodies

Catalog No.:
ATL-HPA069509-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: nitric oxide synthase 1
Gene Name: NOS1
Alternative Gene Name: nNOS, NOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029361: 91%, ENSRNOG00000001130: 91%
Entrez Gene ID: 4842
Uniprot ID: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD
Gene Sequence DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD
Gene ID - Mouse ENSMUSG00000029361
Gene ID - Rat ENSRNOG00000001130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NOS1 pAb (ATL-HPA069509)
Datasheet Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link)
Vendor Page Anti NOS1 pAb (ATL-HPA069509) at Atlas Antibodies

Documents & Links for Anti NOS1 pAb (ATL-HPA069509)
Datasheet Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link)
Vendor Page Anti NOS1 pAb (ATL-HPA069509)