Anti NFIA pAb (ATL-HPA008884 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008884-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: NFIA
Alternative Gene Name: KIAA1439, NFI-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028565: 99%, ENSRNOG00000006966: 100%
Entrez Gene ID: 4774
Uniprot ID: Q12857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA |
Gene Sequence | VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA |
Gene ID - Mouse | ENSMUSG00000028565 |
Gene ID - Rat | ENSRNOG00000006966 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) | |
Datasheet | Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) | |
Datasheet | Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) |
Citations for Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) – 5 Found |
Pajtler, Kristian W; Wei, Yiju; Okonechnikov, Konstantin; Silva, Patricia B G; Vouri, Mikaella; Zhang, Lei; Brabetz, Sebastian; Sieber, Laura; Gulley, Melissa; Mauermann, Monika; Wedig, Tatjana; Mack, Norman; Imamura Kawasawa, Yuka; Sharma, Tanvi; Zuckermann, Marc; Andreiuolo, Felipe; Holland, Eric; Maass, Kendra; Körkel-Qu, Huiqin; Liu, Hai-Kun; Sahm, Felix; Capper, David; Bunt, Jens; Richards, Linda J; Jones, David T W; Korshunov, Andrey; Chavez, Lukas; Lichter, Peter; Hoshino, Mikio; Pfister, Stefan M; Kool, Marcel; Li, Wei; Kawauchi, Daisuke. YAP1 subgroup supratentorial ependymoma requires TEAD and nuclear factor I-mediated transcriptional programmes for tumorigenesis. Nature Communications. 2019;10(1):3914. PubMed |
Bunt, Jens; Lim, Jonathan W C; Zhao, Lu; Mason, Sharon; Richards, Linda J. PAX6 does not regulate Nfia and Nfib expression during neocortical development. Scientific Reports. 2015;5( 26021864):10668. PubMed |
Hickey, Stephanie L; Berto, Stefano; Konopka, Genevieve. Chromatin Decondensation by FOXP2 Promotes Human Neuron Maturation and Expression of Neurodevelopmental Disease Genes. Cell Reports. 2019;27(6):1699-1711.e9. PubMed |
Bunt, Jens; Osinski, Jason M; Lim, Jonathan Wc; Vidovic, Diana; Ye, Yunan; Zalucki, Oressia; O'Connor, Timothy R; Harris, Lachlan; Gronostajski, Richard M; Richards, Linda J; Piper, Michael. Combined allelic dosage of Nfia and Nfib regulates cortical development. Brain And Neuroscience Advances. 2017;1( 32166136):2398212817739433. PubMed |
Qin, Kunhua; Huang, Peng; Feng, Ruopeng; Keller, Cheryl A; Peslak, Scott A; Khandros, Eugene; Saari, Megan S; Lan, Xianjiang; Mayuranathan, Thiyagaraj; Doerfler, Phillip A; Abdulmalik, Osheiza; Giardine, Belinda; Chou, Stella T; Shi, Junwei; Hardison, Ross C; Weiss, Mitchell J; Blobel, Gerd A. Dual function NFI factors control fetal hemoglobin silencing in adult erythroid cells. Nature Genetics. 2022;54(6):874-884. PubMed |