Anti NFIA pAb (ATL-HPA008884 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008884-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear factor I/A
Gene Name: NFIA
Alternative Gene Name: KIAA1439, NFI-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028565: 99%, ENSRNOG00000006966: 100%
Entrez Gene ID: 4774
Uniprot ID: Q12857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA
Gene Sequence VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA
Gene ID - Mouse ENSMUSG00000028565
Gene ID - Rat ENSRNOG00000006966
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFIA pAb (ATL-HPA008884 w/enhanced validation)
Datasheet Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NFIA pAb (ATL-HPA008884 w/enhanced validation)
Datasheet Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NFIA pAb (ATL-HPA008884 w/enhanced validation)
Citations for Anti NFIA pAb (ATL-HPA008884 w/enhanced validation) – 5 Found
Pajtler, Kristian W; Wei, Yiju; Okonechnikov, Konstantin; Silva, Patricia B G; Vouri, Mikaella; Zhang, Lei; Brabetz, Sebastian; Sieber, Laura; Gulley, Melissa; Mauermann, Monika; Wedig, Tatjana; Mack, Norman; Imamura Kawasawa, Yuka; Sharma, Tanvi; Zuckermann, Marc; Andreiuolo, Felipe; Holland, Eric; Maass, Kendra; Körkel-Qu, Huiqin; Liu, Hai-Kun; Sahm, Felix; Capper, David; Bunt, Jens; Richards, Linda J; Jones, David T W; Korshunov, Andrey; Chavez, Lukas; Lichter, Peter; Hoshino, Mikio; Pfister, Stefan M; Kool, Marcel; Li, Wei; Kawauchi, Daisuke. YAP1 subgroup supratentorial ependymoma requires TEAD and nuclear factor I-mediated transcriptional programmes for tumorigenesis. Nature Communications. 2019;10(1):3914.  PubMed
Bunt, Jens; Lim, Jonathan W C; Zhao, Lu; Mason, Sharon; Richards, Linda J. PAX6 does not regulate Nfia and Nfib expression during neocortical development. Scientific Reports. 2015;5( 26021864):10668.  PubMed
Hickey, Stephanie L; Berto, Stefano; Konopka, Genevieve. Chromatin Decondensation by FOXP2 Promotes Human Neuron Maturation and Expression of Neurodevelopmental Disease Genes. Cell Reports. 2019;27(6):1699-1711.e9.  PubMed
Bunt, Jens; Osinski, Jason M; Lim, Jonathan Wc; Vidovic, Diana; Ye, Yunan; Zalucki, Oressia; O'Connor, Timothy R; Harris, Lachlan; Gronostajski, Richard M; Richards, Linda J; Piper, Michael. Combined allelic dosage of Nfia and Nfib regulates cortical development. Brain And Neuroscience Advances. 2017;1( 32166136):2398212817739433.  PubMed
Qin, Kunhua; Huang, Peng; Feng, Ruopeng; Keller, Cheryl A; Peslak, Scott A; Khandros, Eugene; Saari, Megan S; Lan, Xianjiang; Mayuranathan, Thiyagaraj; Doerfler, Phillip A; Abdulmalik, Osheiza; Giardine, Belinda; Chou, Stella T; Shi, Junwei; Hardison, Ross C; Weiss, Mitchell J; Blobel, Gerd A. Dual function NFI factors control fetal hemoglobin silencing in adult erythroid cells. Nature Genetics. 2022;54(6):874-884.  PubMed