Anti NCS1 pAb (ATL-HPA019713 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019713-25

Protein Description: neuronal calcium sensor 1
Gene Name: NCS1
Alternative Gene Name: FREQ, NCS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062661: 100%, ENSRNOG00000008761: 100%
Entrez Gene ID: 23413
Uniprot ID: P62166
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
• Gene Sequence: YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
• Gene ID - Mouse: ENSMUSG00000062661
• Gene ID - Rat: ENSRNOG00000008761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.