Anti NCAM2 pAb (ATL-HPA030900)
Atlas Antibodies
- SKU:
- ATL-HPA030900-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NCAM2
Alternative Gene Name: MGC51008, NCAM21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022762: 89%, ENSRNOG00000002126: 91%
Entrez Gene ID: 4685
Uniprot ID: O15394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPY |
| Gene Sequence | NVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPY |
| Gene ID - Mouse | ENSMUSG00000022762 |
| Gene ID - Rat | ENSRNOG00000002126 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCAM2 pAb (ATL-HPA030900) | |
| Datasheet | Anti NCAM2 pAb (ATL-HPA030900) Datasheet (External Link) |
| Vendor Page | Anti NCAM2 pAb (ATL-HPA030900) at Atlas Antibodies |
| Documents & Links for Anti NCAM2 pAb (ATL-HPA030900) | |
| Datasheet | Anti NCAM2 pAb (ATL-HPA030900) Datasheet (External Link) |
| Vendor Page | Anti NCAM2 pAb (ATL-HPA030900) |
| Citations for Anti NCAM2 pAb (ATL-HPA030900) – 1 Found |
| Rodrigues, Robim M; De Kock, Joery; Branson, Steven; Vinken, Mathieu; Meganathan, Kesavan; Chaudhari, Umesh; Sachinidis, Agapios; Govaere, Olivier; Roskams, Tania; De Boe, Veerle; Vanhaecke, Tamara; Rogiers, Vera. Human skin-derived stem cells as a novel cell source for in vitro hepatotoxicity screening of pharmaceuticals. Stem Cells And Development. 2014;23(1):44-55. PubMed |