Anti MYH15 pAb (ATL-HPA057915)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057915-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MYH15
Alternative Gene Name: KIAA1000
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092009: 69%, ENSRNOG00000061038: 69%
Entrez Gene ID: 22989
Uniprot ID: Q9Y2K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGENAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFE |
Gene Sequence | LGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGENAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFE |
Gene ID - Mouse | ENSMUSG00000092009 |
Gene ID - Rat | ENSRNOG00000061038 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MYH15 pAb (ATL-HPA057915) | |
Datasheet | Anti MYH15 pAb (ATL-HPA057915) Datasheet (External Link) |
Vendor Page | Anti MYH15 pAb (ATL-HPA057915) at Atlas Antibodies |
Documents & Links for Anti MYH15 pAb (ATL-HPA057915) | |
Datasheet | Anti MYH15 pAb (ATL-HPA057915) Datasheet (External Link) |
Vendor Page | Anti MYH15 pAb (ATL-HPA057915) |