Anti MRPS28 pAb (ATL-HPA027202)

Atlas Antibodies

Catalog No.: ATL-HPA027202-25

Protein Description: mitochondrial ribosomal protein S28
Gene Name: MRPS28
Alternative Gene Name: HSPC007, MRP-S28, MRPS35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040269: 62%, ENSRNOG00000032630: 60%
Entrez Gene ID: 28957
Uniprot ID: Q9Y2Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQM
• Gene Sequence: MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQM
• Gene ID - Mouse: ENSMUSG00000040269
• Gene ID - Rat: ENSRNOG00000032630
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.