Anti MDM1 pAb (ATL-HPA040411)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040411-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MDM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020212: 67%, ENSRNOG00000007286: 66%
Entrez Gene ID: 56890
Uniprot ID: Q8TC05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKR |
Gene Sequence | NNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKR |
Gene ID - Mouse | ENSMUSG00000020212 |
Gene ID - Rat | ENSRNOG00000007286 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MDM1 pAb (ATL-HPA040411) | |
Datasheet | Anti MDM1 pAb (ATL-HPA040411) Datasheet (External Link) |
Vendor Page | Anti MDM1 pAb (ATL-HPA040411) at Atlas Antibodies |
Documents & Links for Anti MDM1 pAb (ATL-HPA040411) | |
Datasheet | Anti MDM1 pAb (ATL-HPA040411) Datasheet (External Link) |
Vendor Page | Anti MDM1 pAb (ATL-HPA040411) |