Anti MDM1 pAb (ATL-HPA040411)

Atlas Antibodies

Catalog No.:
ATL-HPA040411-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Mdm1 nuclear protein homolog (mouse)
Gene Name: MDM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020212: 67%, ENSRNOG00000007286: 66%
Entrez Gene ID: 56890
Uniprot ID: Q8TC05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKR
Gene Sequence NNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKR
Gene ID - Mouse ENSMUSG00000020212
Gene ID - Rat ENSRNOG00000007286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MDM1 pAb (ATL-HPA040411)
Datasheet Anti MDM1 pAb (ATL-HPA040411) Datasheet (External Link)
Vendor Page Anti MDM1 pAb (ATL-HPA040411) at Atlas Antibodies

Documents & Links for Anti MDM1 pAb (ATL-HPA040411)
Datasheet Anti MDM1 pAb (ATL-HPA040411) Datasheet (External Link)
Vendor Page Anti MDM1 pAb (ATL-HPA040411)