Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA074653-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-LINGO1 antibody. Corresponding LINGO1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat and Ig domain containing 1
Gene Name: LINGO1
Alternative Gene Name: FLJ14594, LERN1, LRRN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049556: 100%, ENSRNOG00000017193: 100%
Entrez Gene ID: 84894
Uniprot ID: Q96FE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Gene Sequence TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Gene ID - Mouse ENSMUSG00000049556
Gene ID - Rat ENSRNOG00000017193
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation)
Datasheet Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LINGO1 pAb (ATL-HPA074653 w/enhanced validation)