Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024629-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Kruppel-like factor 17
Gene Name: KLF17
Alternative Gene Name: FLJ40160, Zfp393, ZNF393
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048626: 42%, ENSRNOG00000019479: 46%
Entrez Gene ID: 128209
Uniprot ID: Q5JT82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTG
Gene Sequence TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTG
Gene ID - Mouse ENSMUSG00000048626
Gene ID - Rat ENSRNOG00000019479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation)
Datasheet Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation)
Datasheet Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation)
Citations for Anti KLF17 pAb (ATL-HPA024629 w/enhanced validation) – 12 Found
Blakeley, Paul; Fogarty, Norah M E; del Valle, Ignacio; Wamaitha, Sissy E; Hu, Tim Xiaoming; Elder, Kay; Snell, Philip; Christie, Leila; Robson, Paul; Niakan, Kathy K. Defining the three cell lineages of the human blastocyst by single-cell RNA-seq. Development (Cambridge, England). 2015;142(18):3151-65.  PubMed
Zimmerlin, Ludovic; Park, Tea Soon; Huo, Jeffrey S; Verma, Karan; Pather, Sarshan R; Talbot, C Conover Jr; Agarwal, Jasmin; Steppan, Diana; Zhang, Yang W; Considine, Michael; Guo, Hong; Zhong, Xiufeng; Gutierrez, Christian; Cope, Leslie; Canto-Soler, M Valeria; Friedman, Alan D; Baylin, Stephen B; Zambidis, Elias T. Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality. Development (Cambridge, England). 2016;143(23):4368-4380.  PubMed
Collier, Amanda J; Panula, Sarita P; Schell, John Paul; Chovanec, Peter; Plaza Reyes, Alvaro; Petropoulos, Sophie; Corcoran, Anne E; Walker, Rachael; Douagi, Iyadh; Lanner, Fredrik; Rugg-Gunn, Peter J. Comprehensive Cell Surface Protein Profiling Identifies Specific Markers of Human Naive and Primed Pluripotent States. Cell Stem Cell. 2017;20(6):874-890.e7.  PubMed
Di Stefano, Bruno; Ueda, Mai; Sabri, Shan; Brumbaugh, Justin; Huebner, Aaron J; Sahakyan, Anna; Clement, Kendell; Clowers, Katie J; Erickson, Alison R; Shioda, Keiko; Gygi, Steven P; Gu, Hongcang; Shioda, Toshi; Meissner, Alexander; Takashima, Yasuhiro; Plath, Kathrin; Hochedlinger, Konrad. Reduced MEK inhibition preserves genomic stability in naive human embryonic stem cells. Nature Methods. 2018;15(9):732-740.  PubMed
Guo, Ge; Stirparo, Giuliano Giuseppe; Strawbridge, Stanley E; Spindlow, Daniel; Yang, Jian; Clarke, James; Dattani, Anish; Yanagida, Ayaka; Li, Meng Amy; Myers, Sam; Özel, Buse Nurten; Nichols, Jennifer; Smith, Austin. Human naive epiblast cells possess unrestricted lineage potential. Cell Stem Cell. 2021;28(6):1040-1056.e6.  PubMed
Collier, Amanda J; Bendall, Adam; Fabian, Charlene; Malcolm, Andrew A; Tilgner, Katarzyna; Semprich, Claudia I; Wojdyla, Katarzyna; Nisi, Paola Serena; Kishore, Kamal; Roamio Franklin, Valar Nila; Mirshekar-Syahkal, Bahar; D'Santos, Clive; Plath, Kathrin; Yusa, Kosuke; Rugg-Gunn, Peter J. Genome-wide screening identifies Polycomb repressive complex 1.3 as an essential regulator of human naïve pluripotent cell reprogramming. Science Advances. 2022;8(12):eabk0013.  PubMed
Pastor, William A; Liu, Wanlu; Chen, Di; Ho, Jamie; Kim, Rachel; Hunt, Timothy J; Lukianchikov, Anastasia; Liu, Xiaodong; Polo, Jose M; Jacobsen, Steven E; Clark, Amander T. TFAP2C regulates transcription in human naive pluripotency by opening enhancers. Nature Cell Biology. 2018;20(5):553-564.  PubMed
Bredenkamp, Nicholas; Yang, Jian; Clarke, James; Stirparo, Giuliano Giuseppe; von Meyenn, Ferdinand; Dietmann, Sabine; Baker, Duncan; Drummond, Rosalind; Ren, Yongming; Li, Dongwei; Wu, Chuman; Rostovskaya, Maria; Eminli-Meissner, Sarah; Smith, Austin; Guo, Ge. Wnt Inhibition Facilitates RNA-Mediated Reprogramming of Human Somatic Cells to Naive Pluripotency. Stem Cell Reports. 2019;13(6):1083-1098.  PubMed
Yanagida, Ayaka; Spindlow, Daniel; Nichols, Jennifer; Dattani, Anish; Smith, Austin; Guo, Ge. Naive stem cell blastocyst model captures human embryo lineage segregation. Cell Stem Cell. 2021;28(6):1016-1022.e4.  PubMed
Ruan, Degong; Ye, Zi-Wei; Yuan, Shuofeng; Li, Zhuoxuan; Zhang, Weiyu; Ong, Chon Phin; Tang, Kaiming; Ka Ki Tam, Timothy Theodore; Guo, Jilong; Xuan, Yiyi; Huang, Yunying; Zhang, Qingqing; Lee, Cheuk-Lun; Lu, Liming; Chiu, Philip C N; Yeung, William S B; Liu, Fang; Jin, Dong-Yan; Liu, Pentao. Human early syncytiotrophoblasts are highly susceptible to SARS-CoV-2 infection. Cell Reports. Medicine. 2022;3(12):100849.  PubMed
Sevinç, Kenan; Sevinç, Gülben Gürhan; Cavga, Ayşe Derya; Philpott, Martin; Kelekçi, Simge; Can, Hazal; Cribbs, Adam P; Yıldız, Abdullah Burak; Yılmaz, Alperen; Ayar, Enes Sefa; Arabacı, Dilşad H; Dunford, James E; Ata, Deniz; Sigua, Logan H; Qi, Jun; Oppermann, Udo; Onder, Tamer T. BRD9-containing non-canonical BAF complex maintains somatic cell transcriptome and acts as a barrier to human reprogramming. Stem Cell Reports. 2022;17(12):2629-2642.  PubMed
Bayerl, Jonathan; Ayyash, Muneef; Shani, Tom; Manor, Yair Shlomo; Gafni, Ohad; Massarwa, Rada; Kalma, Yael; Aguilera-Castrejon, Alejandro; Zerbib, Mirie; Amir, Hadar; Sheban, Daoud; Geula, Shay; Mor, Nofar; Weinberger, Leehee; Naveh Tassa, Segev; Krupalnik, Vladislav; Oldak, Bernardo; Livnat, Nir; Tarazi, Shadi; Tawil, Shadi; Wildschutz, Emilie; Ashouokhi, Shahd; Lasman, Lior; Rotter, Varda; Hanna, Suhair; Ben-Yosef, Dalit; Novershtern, Noa; Viukov, Sergey; Hanna, Jacob H. Principles of signaling pathway modulation for enhancing human naive pluripotency induction. Cell Stem Cell. 2021;28(9):1549-1565.e12.  PubMed