Anti IP6K3 pAb (ATL-HPA062531)

Atlas Antibodies

Catalog No.:
ATL-HPA062531-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: inositol hexakisphosphate kinase 3
Gene Name: IP6K3
Alternative Gene Name: IHPK3, INSP6K3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024210: 42%, ENSRNOG00000025883: 49%
Entrez Gene ID: 117283
Uniprot ID: Q96PC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID
Gene Sequence LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID
Gene ID - Mouse ENSMUSG00000024210
Gene ID - Rat ENSRNOG00000025883
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IP6K3 pAb (ATL-HPA062531)
Datasheet Anti IP6K3 pAb (ATL-HPA062531) Datasheet (External Link)
Vendor Page Anti IP6K3 pAb (ATL-HPA062531) at Atlas Antibodies

Documents & Links for Anti IP6K3 pAb (ATL-HPA062531)
Datasheet Anti IP6K3 pAb (ATL-HPA062531) Datasheet (External Link)
Vendor Page Anti IP6K3 pAb (ATL-HPA062531)