Anti IL20RB pAb (ATL-HPA063914)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063914-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IL20RB
Alternative Gene Name: DIRS1, FNDC6, IL-20R2, MGC34923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044244: 85%, ENSRNOG00000023214: 76%
Entrez Gene ID: 53833
Uniprot ID: Q6UXL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE |
Gene Sequence | QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE |
Gene ID - Mouse | ENSMUSG00000044244 |
Gene ID - Rat | ENSRNOG00000023214 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IL20RB pAb (ATL-HPA063914) | |
Datasheet | Anti IL20RB pAb (ATL-HPA063914) Datasheet (External Link) |
Vendor Page | Anti IL20RB pAb (ATL-HPA063914) at Atlas Antibodies |
Documents & Links for Anti IL20RB pAb (ATL-HPA063914) | |
Datasheet | Anti IL20RB pAb (ATL-HPA063914) Datasheet (External Link) |
Vendor Page | Anti IL20RB pAb (ATL-HPA063914) |