Anti HUNK pAb (ATL-HPA027372)

Atlas Antibodies

SKU:
ATL-HPA027372-25
  • Immunohistochemical staining of human gall bladder shows strong granular cytoplasmic and nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: hormonally up-regulated Neu-associated kinase
Gene Name: HUNK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053414: 86%, ENSRNOG00000002092: 86%
Entrez Gene ID: 30811
Uniprot ID: P57058
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG
Gene Sequence NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG
Gene ID - Mouse ENSMUSG00000053414
Gene ID - Rat ENSRNOG00000002092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HUNK pAb (ATL-HPA027372)
Datasheet Anti HUNK pAb (ATL-HPA027372) Datasheet (External Link)
Vendor Page Anti HUNK pAb (ATL-HPA027372) at Atlas Antibodies

Documents & Links for Anti HUNK pAb (ATL-HPA027372)
Datasheet Anti HUNK pAb (ATL-HPA027372) Datasheet (External Link)
Vendor Page Anti HUNK pAb (ATL-HPA027372)