Anti GALR1 pAb (ATL-HPA074584)

Atlas Antibodies

Catalog No.:
ATL-HPA074584-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: galanin receptor 1
Gene Name: GALR1
Alternative Gene Name: GALNR, GALNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024553: 81%, ENSRNOG00000016654: 81%
Entrez Gene ID: 2587
Uniprot ID: P47211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT
Gene Sequence MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT
Gene ID - Mouse ENSMUSG00000024553
Gene ID - Rat ENSRNOG00000016654
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALR1 pAb (ATL-HPA074584)
Datasheet Anti GALR1 pAb (ATL-HPA074584) Datasheet (External Link)
Vendor Page Anti GALR1 pAb (ATL-HPA074584) at Atlas Antibodies

Documents & Links for Anti GALR1 pAb (ATL-HPA074584)
Datasheet Anti GALR1 pAb (ATL-HPA074584) Datasheet (External Link)
Vendor Page Anti GALR1 pAb (ATL-HPA074584)