Anti GADL1 pAb (ATL-HPA039160)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039160-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GADL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056880: 93%, ENSRNOG00000011573: 52%
Entrez Gene ID: 339896
Uniprot ID: Q6ZQY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM |
Gene Sequence | PSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM |
Gene ID - Mouse | ENSMUSG00000056880 |
Gene ID - Rat | ENSRNOG00000011573 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GADL1 pAb (ATL-HPA039160) | |
Datasheet | Anti GADL1 pAb (ATL-HPA039160) Datasheet (External Link) |
Vendor Page | Anti GADL1 pAb (ATL-HPA039160) at Atlas Antibodies |
Documents & Links for Anti GADL1 pAb (ATL-HPA039160) | |
Datasheet | Anti GADL1 pAb (ATL-HPA039160) Datasheet (External Link) |
Vendor Page | Anti GADL1 pAb (ATL-HPA039160) |