Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031684-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid (GABA) B receptor, 2
Gene Name: GABBR2
Alternative Gene Name: GABABR2, GPR51, GPRC3B, HG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039809: 93%, ENSRNOG00000008431: 93%
Entrez Gene ID: 9568
Uniprot ID: O75899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLS
Gene Sequence NPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLS
Gene ID - Mouse ENSMUSG00000039809
Gene ID - Rat ENSRNOG00000008431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation)
Datasheet Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation)
Datasheet Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABBR2 pAb (ATL-HPA031684 w/enhanced validation)