Anti FRS3 pAb (ATL-HPA030174 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030174-25

Protein Description: fibroblast growth factor receptor substrate 3
Gene Name: FRS3
Alternative Gene Name: FRS2B, FRS2beta, SNT-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023266: 92%, ENSRNOG00000014328: 93%
Entrez Gene ID: 10817
Uniprot ID: O43559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT
• Gene Sequence: GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT
• Gene ID - Mouse: ENSMUSG00000023266
• Gene ID - Rat: ENSRNOG00000014328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.