Anti FAM126B pAb (ATL-HPA036166)

Atlas Antibodies

SKU:
ATL-HPA036166-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 126, member B
Gene Name: FAM126B
Alternative Gene Name: HYCC2, MGC39518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038174: 93%, ENSRNOG00000025079: 94%
Entrez Gene ID: 285172
Uniprot ID: Q8IXS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS
Gene Sequence PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS
Gene ID - Mouse ENSMUSG00000038174
Gene ID - Rat ENSRNOG00000025079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM126B pAb (ATL-HPA036166)
Datasheet Anti FAM126B pAb (ATL-HPA036166) Datasheet (External Link)
Vendor Page Anti FAM126B pAb (ATL-HPA036166) at Atlas Antibodies

Documents & Links for Anti FAM126B pAb (ATL-HPA036166)
Datasheet Anti FAM126B pAb (ATL-HPA036166) Datasheet (External Link)
Vendor Page Anti FAM126B pAb (ATL-HPA036166)