Anti FAM126B pAb (ATL-HPA036166)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036166-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM126B
Alternative Gene Name: HYCC2, MGC39518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038174: 93%, ENSRNOG00000025079: 94%
Entrez Gene ID: 285172
Uniprot ID: Q8IXS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS |
Gene Sequence | PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS |
Gene ID - Mouse | ENSMUSG00000038174 |
Gene ID - Rat | ENSRNOG00000025079 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM126B pAb (ATL-HPA036166) | |
Datasheet | Anti FAM126B pAb (ATL-HPA036166) Datasheet (External Link) |
Vendor Page | Anti FAM126B pAb (ATL-HPA036166) at Atlas Antibodies |
Documents & Links for Anti FAM126B pAb (ATL-HPA036166) | |
Datasheet | Anti FAM126B pAb (ATL-HPA036166) Datasheet (External Link) |
Vendor Page | Anti FAM126B pAb (ATL-HPA036166) |