Anti EGR3 pAb (ATL-HPA006206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006206-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EGR3
Alternative Gene Name: PILOT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033730: 100%, ENSRNOG00000017828: 100%
Entrez Gene ID: 1960
Uniprot ID: Q06889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSD |
Gene Sequence | EPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSD |
Gene ID - Mouse | ENSMUSG00000033730 |
Gene ID - Rat | ENSRNOG00000017828 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EGR3 pAb (ATL-HPA006206) | |
Datasheet | Anti EGR3 pAb (ATL-HPA006206) Datasheet (External Link) |
Vendor Page | Anti EGR3 pAb (ATL-HPA006206) at Atlas Antibodies |
Documents & Links for Anti EGR3 pAb (ATL-HPA006206) | |
Datasheet | Anti EGR3 pAb (ATL-HPA006206) Datasheet (External Link) |
Vendor Page | Anti EGR3 pAb (ATL-HPA006206) |
Citations for Anti EGR3 pAb (ATL-HPA006206) – 1 Found |
Pio, Rebecca; Jia, Zhenyu; Baron, Veronique T; Mercola, Dan. Early growth response 3 (Egr3) is highly over-expressed in non-relapsing prostate cancer but not in relapsing prostate cancer. Plos One. 8(1):e54096. PubMed |