Anti DDX17 pAb (ATL-HPA063142)

Atlas Antibodies

Catalog No.: ATL-HPA063142-25

Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 17
Gene Name: DDX17
Alternative Gene Name: P72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055065: 96%, ENSRNOG00000051170: 96%
Entrez Gene ID: 10521
Uniprot ID: Q92841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ
• Gene Sequence: GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ
• Gene ID - Mouse: ENSMUSG00000055065
• Gene ID - Rat: ENSRNOG00000051170
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.