Anti DCC pAb (ATL-HPA055376)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055376-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DCC
Alternative Gene Name: IGDCC1, NTN1R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060534: 96%, ENSRNOG00000033099: 96%
Entrez Gene ID: 1630
Uniprot ID: P43146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN |
Gene Sequence | GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN |
Gene ID - Mouse | ENSMUSG00000060534 |
Gene ID - Rat | ENSRNOG00000033099 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCC pAb (ATL-HPA055376) | |
Datasheet | Anti DCC pAb (ATL-HPA055376) Datasheet (External Link) |
Vendor Page | Anti DCC pAb (ATL-HPA055376) at Atlas Antibodies |
Documents & Links for Anti DCC pAb (ATL-HPA055376) | |
Datasheet | Anti DCC pAb (ATL-HPA055376) Datasheet (External Link) |
Vendor Page | Anti DCC pAb (ATL-HPA055376) |