Anti CYP2S1 pAb (ATL-HPA049227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049227-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CYP2S1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040703: 82%, ENSRNOG00000020743: 80%
Entrez Gene ID: 29785
Uniprot ID: Q96SQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL |
Gene Sequence | GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL |
Gene ID - Mouse | ENSMUSG00000040703 |
Gene ID - Rat | ENSRNOG00000020743 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYP2S1 pAb (ATL-HPA049227) | |
Datasheet | Anti CYP2S1 pAb (ATL-HPA049227) Datasheet (External Link) |
Vendor Page | Anti CYP2S1 pAb (ATL-HPA049227) at Atlas Antibodies |
Documents & Links for Anti CYP2S1 pAb (ATL-HPA049227) | |
Datasheet | Anti CYP2S1 pAb (ATL-HPA049227) Datasheet (External Link) |
Vendor Page | Anti CYP2S1 pAb (ATL-HPA049227) |