Anti COBL pAb (ATL-HPA019167 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019167-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cordon-bleu WH2 repeat protein
Gene Name: COBL
Alternative Gene Name: KIAA0633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020173: 94%, ENSRNOG00000004281: 92%
Entrez Gene ID: 23242
Uniprot ID: O75128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT
Gene Sequence AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT
Gene ID - Mouse ENSMUSG00000020173
Gene ID - Rat ENSRNOG00000004281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation)
Datasheet Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COBL pAb (ATL-HPA019167 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation)
Datasheet Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COBL pAb (ATL-HPA019167 w/enhanced validation)
Citations for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) – 2 Found
Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15.  PubMed
Cracknell, Tobias; Mannsverk, Steinar; Nichols, Angus; Dowle, Adam; Blanco, Gonzalo. Proteomic resolution of IGFN1 complexes reveals a functional interaction with the actin nucleating protein COBL. Experimental Cell Research. 2020;395(2):112179.  PubMed