Anti CLPTM1L pAb (ATL-HPA014791 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014791-25

Protein Description: CLPTM1-like
Gene Name: CLPTM1L
Alternative Gene Name: CRR9, FLJ14400
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021610: 91%, ENSRNOG00000016923: 93%
Entrez Gene ID: 81037
Uniprot ID: Q96KA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
• Gene Sequence: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
• Gene ID - Mouse: ENSMUSG00000021610
• Gene ID - Rat: ENSRNOG00000016923
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLPTM1L pAb (ATL-HPA014791 w/enhanced validation) – 7 Found

Puskás, László G; Mán, Imola; Szebeni, Gabor; Tiszlavicz, László; Tsai, Susan; James, Michael A. Novel Anti-CRR9/CLPTM1L Antibodies with Antitumorigenic Activity Inhibit Cell Surface Accumulation, PI3K Interaction, and Survival Signaling. Molecular Cancer Therapeutics. 2016;15(5):985-97. 

Tsai, Susan; McOlash, Laura; Palen, Katie; Johnson, Bryon; Duris, Christine; Yang, Qiuhui; Dwinell, Michael B; Hunt, Bryan; Evans, Douglas B; Gershan, Jill; James, Michael A. Development of primary human pancreatic cancer organoids, matched stromal and immune cells and 3D tumor microenvironment models. Bmc Cancer. 2018;18(1):335. 

Trezise, Stephanie; Karnowski, Alexander; Fedele, Pasquale L; Mithraprabhu, Sridurga; Liao, Yang; D'Costa, Kathy; Kueh, Andrew J; Hardy, Matthew P; Owczarek, Catherine M; Herold, Marco J; Spencer, Andrew; Shi, Wei; Willis, Simon N; Nutt, Stephen L; Corcoran, Lynn M. Mining the Plasma Cell Transcriptome for Novel Cell Surface Proteins. International Journal Of Molecular Sciences. 2018;19(8) 

Hou, Yunwen; Xue, Feifei; Fu, Yu; Feng, Guanying; Wang, Ruixia; Yuan, Hua. CLPTM1L Is a Novel Putative Oncogene Promoting Tumorigenesis in Oral Squamous Cell Carcinoma. Cell Transplantation. 2021;30( 34586883):9636897211045970. 

Jia, Jinping; Bosley, Allen D; Thompson, Abbey; Hoskins, Jason W; Cheuk, Adam; Collins, Irene; Parikh, Hemang; Xiao, Zhen; Ylaya, Kris; Dzyadyk, Marta; Cozen, Wendy; Hernandez, Brenda Y; Lynch, Charles F; Loncarek, Jadranka; Altekruse, Sean F; Zhang, Lizhi; Westlake, Christopher J; Factor, Valentina M; Thorgeirsson, Snorri; Bamlet, William R; Hewitt, Stephen M; Petersen, Gloria M; Andresson, Thorkell; Amundadottir, Laufey T. CLPTM1L promotes growth and enhances aneuploidy in pancreatic cancer cells. Cancer Research. 2014;74(10):2785-95. 

Zhang, Yang; Zhang, Xiaoai; Zhang, Hongxing; Zhai, Yun; Wang, Zhifu; Li, Peiyao; Yu, Lixia; Xia, Xia; Zhang, Ying; Zeng, Yixin; He, Fuchu; Zhou, Gangqiao. Common variations in TERT-CLPTM1L locus are reproducibly associated with the risk of nasopharyngeal carcinoma in Chinese populations. Oncotarget. 2016;7(1):759-70. 

Li, Hang; Che, Jun; Jiang, Mian; Cui, Ming; Feng, Guoxing; Dong, Jiali; Zhang, Shuqin; Lu, Lu; Liu, Weili; Fan, Saijun. CLPTM1L induces estrogen receptor β signaling-mediated radioresistance in non-small cell lung cancer cells. Cell Communication And Signaling : Ccs. 2020;18(1):152.