Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037017-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CGGBP1
Alternative Gene Name: CGGBP, p20-CGGBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054604: 96%, ENSRNOG00000000718: 100%
Entrez Gene ID: 8545
Uniprot ID: Q9UFW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQD |
Gene Sequence | PLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQD |
Gene ID - Mouse | ENSMUSG00000054604 |
Gene ID - Rat | ENSRNOG00000000718 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) | |
Datasheet | Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) | |
Datasheet | Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) |