Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA021669-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cerebral cavernous malformation 2
Gene Name: CCM2
Alternative Gene Name: C7orf22, MGC4607
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000378: 99%, ENSRNOG00000060825: 98%
Entrez Gene ID: 83605
Uniprot ID: Q9BSQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSR
Gene Sequence GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSR
Gene ID - Mouse ENSMUSG00000000378
Gene ID - Rat ENSRNOG00000060825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation)
Datasheet Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation)
Datasheet Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation)