Anti CALCOCO2 pAb (ATL-HPA022989 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022989-25

Protein Description: calcium binding and coiled-coil domain 2
Gene Name: CALCOCO2
Alternative Gene Name: MGC17318, NDP52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040407: 33%, ENSRNOG00000026319: 34%
Entrez Gene ID: 10241
Uniprot ID: Q13137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLT
• Gene Sequence: SINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLT
• Gene ID - Mouse: ENSMUSG00000040407
• Gene ID - Rat: ENSRNOG00000026319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALCOCO2 pAb (ATL-HPA022989 w/enhanced validation) – 1 Found

Pablos, Isabel; Machado, Yoan; de Jesus, Hugo C Ramos; Mohamud, Yasir; Kappelhoff, Reinhild; Lindskog, Cecilia; Vlok, Marli; Bell, Peter A; Butler, Georgina S; Grin, Peter M; Cao, Quynh T; Nguyen, Jenny P; Solis, Nestor; Abbina, Srinivas; Rut, Wioletta; Vederas, John C; Szekely, Laszlo; Szakos, Attila; Drag, Marcin; Kizhakkedathu, Jayachandran N; Mossman, Karen; Hirota, Jeremy A; Jan, Eric; Luo, Honglin; Banerjee, Arinjay; Overall, Christopher M. Mechanistic insights into COVID-19 by global analysis of the SARS-CoV-2 3CL(pro) substrate degradome. Cell Reports. 2021;37(4):109892.