Anti CACNG6 pAb (ATL-HPA056615)

Atlas Antibodies

Catalog No.:
ATL-HPA056615-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcium channel, voltage-dependent, gamma subunit 6
Gene Name: CACNG6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097894: 91%, ENSRNOG00000057852: 90%
Entrez Gene ID: 59285
Uniprot ID: Q9BXT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTK
Gene Sequence NTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTK
Gene ID - Mouse ENSMUSG00000097894
Gene ID - Rat ENSRNOG00000057852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACNG6 pAb (ATL-HPA056615)
Datasheet Anti CACNG6 pAb (ATL-HPA056615) Datasheet (External Link)
Vendor Page Anti CACNG6 pAb (ATL-HPA056615) at Atlas Antibodies

Documents & Links for Anti CACNG6 pAb (ATL-HPA056615)
Datasheet Anti CACNG6 pAb (ATL-HPA056615) Datasheet (External Link)
Vendor Page Anti CACNG6 pAb (ATL-HPA056615)