Anti C12orf29 pAb (ATL-HPA039663)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039663-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C12orf29
Alternative Gene Name: DKFZp434N2030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046567: 84%, ENSRNOG00000006973: 85%
Entrez Gene ID: 91298
Uniprot ID: Q8N999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA |
Gene Sequence | QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA |
Gene ID - Mouse | ENSMUSG00000046567 |
Gene ID - Rat | ENSRNOG00000006973 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C12orf29 pAb (ATL-HPA039663) | |
Datasheet | Anti C12orf29 pAb (ATL-HPA039663) Datasheet (External Link) |
Vendor Page | Anti C12orf29 pAb (ATL-HPA039663) at Atlas Antibodies |
Documents & Links for Anti C12orf29 pAb (ATL-HPA039663) | |
Datasheet | Anti C12orf29 pAb (ATL-HPA039663) Datasheet (External Link) |
Vendor Page | Anti C12orf29 pAb (ATL-HPA039663) |