Anti C11orf96 pAb (ATL-HPA038843)

Atlas Antibodies

Catalog No.:
ATL-HPA038843-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 96
Gene Name: C11orf96
Alternative Gene Name: AG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087006: 97%, ENSRNOG00000055564: 97%
Entrez Gene ID: 387763
Uniprot ID: Q7Z7L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
Gene Sequence RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
Gene ID - Mouse ENSMUSG00000087006
Gene ID - Rat ENSRNOG00000055564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf96 pAb (ATL-HPA038843)
Datasheet Anti C11orf96 pAb (ATL-HPA038843) Datasheet (External Link)
Vendor Page Anti C11orf96 pAb (ATL-HPA038843) at Atlas Antibodies

Documents & Links for Anti C11orf96 pAb (ATL-HPA038843)
Datasheet Anti C11orf96 pAb (ATL-HPA038843) Datasheet (External Link)
Vendor Page Anti C11orf96 pAb (ATL-HPA038843)