Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030947-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BDH1
Alternative Gene Name: BDH, SDR9C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046598: 90%, ENSRNOG00000001736: 91%
Entrez Gene ID: 622
Uniprot ID: Q02338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL |
Gene Sequence | ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL |
Gene ID - Mouse | ENSMUSG00000046598 |
Gene ID - Rat | ENSRNOG00000001736 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) | |
Datasheet | Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) | |
Datasheet | Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) |
Citations for Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) – 4 Found |
Stagg, David B; Gillingham, Jacob R; Nelson, Alisa B; Lengfeld, Justin E; d'Avignon, D André; Puchalska, Patrycja; Crawford, Peter A. Diminished ketone interconversion, hepatic TCA cycle flux, and glucose production in D-β-hydroxybutyrate dehydrogenase hepatocyte-deficient mice. Molecular Metabolism. 2021;53( 34116232):101269. PubMed |
Liśkiewicz, Daniela; Liśkiewicz, Arkadiusz; Nowacka-Chmielewska, Marta M; Grabowski, Mateusz; Pondel, Natalia; Grabowska, Konstancja; Student, Sebastian; Barski, Jaroslaw J; Małecki, Andrzej. Differential Response of Hippocampal and Cerebrocortical Autophagy and Ketone Body Metabolism to the Ketogenic Diet. Frontiers In Cellular Neuroscience. 15( 34456688):733607. PubMed |
Scafidi, Susanna; Jernberg, Jennifer; Fiskum, Gary; McKenna, Mary C. Metabolism of Exogenous [2,4-(13)C]β-Hydroxybutyrate following Traumatic Brain Injury in 21-22-Day-Old Rats: An Ex Vivo NMR Study. Metabolites. 2022;12(8) PubMed |
Labanca, Estefania; Bizzotto, Juan; Sanchis, Pablo; Anselmino, Nicolas; Yang, Jun; Shepherd, Peter D A; Paez, Alejandra; Antico-Arciuch, Valeria; Lage-Vickers, Sofia; Hoang, Anh G; Tang, Ximing; Raso, Maria Gabriela; Titus, Mark; Efstathiou, Eleni; Cotignola, Javier; Araujo, John; Logothetis, Christopher; Vazquez, Elba; Navone, Nora; Gueron, Geraldine. Prostate cancer castrate resistant progression usage of non-canonical androgen receptor signaling and ketone body fuel. Oncogene. 2021;40(44):6284-6298. PubMed |