Anti BAG4 pAb (ATL-HPA018951)

Atlas Antibodies

Catalog No.:
ATL-HPA018951-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BCL2-associated athanogene 4
Gene Name: BAG4
Alternative Gene Name: SODD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037316: 82%, ENSRNOG00000042560: 81%
Entrez Gene ID: 9530
Uniprot ID: O95429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQ
Gene Sequence VHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQ
Gene ID - Mouse ENSMUSG00000037316
Gene ID - Rat ENSRNOG00000042560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAG4 pAb (ATL-HPA018951)
Datasheet Anti BAG4 pAb (ATL-HPA018951) Datasheet (External Link)
Vendor Page Anti BAG4 pAb (ATL-HPA018951) at Atlas Antibodies

Documents & Links for Anti BAG4 pAb (ATL-HPA018951)
Datasheet Anti BAG4 pAb (ATL-HPA018951) Datasheet (External Link)
Vendor Page Anti BAG4 pAb (ATL-HPA018951)