Anti ATF3 pAb (ATL-HPA001562)

Atlas Antibodies

Catalog No.:
ATL-HPA001562-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: activating transcription factor 3
Gene Name: ATF3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026628: 92%, ENSRNOG00000003745: 92%
Entrez Gene ID: 467
Uniprot ID: P18847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Gene Sequence MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Gene ID - Mouse ENSMUSG00000026628
Gene ID - Rat ENSRNOG00000003745
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATF3 pAb (ATL-HPA001562)
Datasheet Anti ATF3 pAb (ATL-HPA001562) Datasheet (External Link)
Vendor Page Anti ATF3 pAb (ATL-HPA001562) at Atlas Antibodies

Documents & Links for Anti ATF3 pAb (ATL-HPA001562)
Datasheet Anti ATF3 pAb (ATL-HPA001562) Datasheet (External Link)
Vendor Page Anti ATF3 pAb (ATL-HPA001562)
Citations for Anti ATF3 pAb (ATL-HPA001562) – 26 Found
Edagawa, Makoto; Kawauchi, Junya; Hirata, Manabu; Goshima, Hiroto; Inoue, Makoto; Okamoto, Tatsuro; Murakami, Akira; Maehara, Yoshihiko; Kitajima, Shigetaka. Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. The Journal Of Biological Chemistry. 2014;289(31):21544-61.  PubMed
Gey, Manuel; Wanner, Renate; Schilling, Corinna; Pedro, Maria T; Sinske, Daniela; Knöll, Bernd. Atf3 mutant mice show reduced axon regeneration and impaired regeneration-associated gene induction after peripheral nerve injury. Open Biology. 2016;6(8)  PubMed
Marwarha, Gurdeep; Rostad, Stephen; Lilek, Jaclyn; Kleinjan, Mason; Schommer, Jared; Ghribi, Othman. Palmitate Increases β-site AβPP-Cleavage Enzyme 1 Activity and Amyloid-β Genesis by Evoking Endoplasmic Reticulum Stress and Subsequent C/EBP Homologous Protein Activation. Journal Of Alzheimer's Disease : Jad. 57(3):907-925.  PubMed
Cheng, Xi; Liu, Jingyu; Shan, Huizhi; Sun, Lihua; Huang, Chenyang; Yan, Qiang; Jiang, Ruiwei; Ding, Lijun; Jiang, Yue; Zhou, Jianjun; Yan, Guijun; Sun, Haixiang. Activating transcription factor 3 promotes embryo attachment via up-regulation of leukemia inhibitory factor in vitro. Reproductive Biology And Endocrinology : Rb&E. 2017;15(1):42.  PubMed
Bueno, Marta; Brands, Judith; Voltz, Lauren; Fiedler, Kaitlin; Mays, Brenton; St Croix, Claudette; Sembrat, John; Mallampalli, Rama K; Rojas, Mauricio; Mora, Ana L. ATF3 represses PINK1 gene transcription in lung epithelial cells to control mitochondrial homeostasis. Aging Cell. 2018;17(2)  PubMed
Allison, Margaret B; Pan, Warren; MacKenzie, Alexander; Patterson, Christa; Shah, Kimi; Barnes, Tammy; Cheng, Wenwen; Rupp, Alan; Olson, David P; Myers, Martin G Jr. Defining the Transcriptional Targets of Leptin Reveals a Role for Atf3 in Leptin Action. Diabetes. 2018;67(6):1093-1104.  PubMed
Wang, Cheng; Tan, Zhijia; Niu, Ben; Tsang, Kwok Yeung; Tai, Andrew; Chan, Wilson C W; Lo, Rebecca L K; Leung, Keith K H; Dung, Nelson W F; Itoh, Nobuyuki; Zhang, Michael Q; Chan, Danny; Cheah, Kathryn Song Eng. Inhibiting the integrated stress response pathway prevents aberrant chondrocyte differentiation thereby alleviating chondrodysplasia. Elife. 2018;7( 30024379)  PubMed
Kaplan, Nihal; Wang, Junyi; Wray, Brian; Patel, Priyam; Yang, Wending; Peng, Han; Lavker, Robert M. Single-Cell RNA Transcriptome Helps Define the Limbal/Corneal Epithelial Stem/Early Transit Amplifying Cells and How Autophagy Affects This Population. Investigative Ophthalmology & Visual Science. 2019;60(10):3570-3583.  PubMed
Robinson, Jake A; Guenthner, Guy; Warfield, Rebecca; Kublin, Jessica R; Smith, Mandy D; Shekarabi, Masoud; Miller, Andrew D; Burdo, Tricia H. Atrophy and Death of Nonpeptidergic and Peptidergic Nociceptive Neurons in SIV Infection. The American Journal Of Pathology. 2020;190(7):1530-1544.  PubMed
Wu, Chieh-Hsin; Lu, Chun-Ching; Huang, Chao-Lan; Wu, Ming-Kung; Lu, Ying-Yi. Increased Expression of Thymic Stromal Lymphopoietin in Chronic Constriction Injury of Rat Nerve. International Journal Of Molecular Sciences. 2021;22(13)  PubMed
Fan, Zheng; Turiel, Guillermo; Ardicoglu, Raphaela; Ghobrial, Moheb; Masschelein, Evi; Kocijan, Tea; Zhang, Jing; Tan, Ge; Fitzgerald, Gillian; Gorski, Tatiane; Alvarado-Diaz, Abdiel; Gilardoni, Paola; Adams, Christopher M; Ghesquière, Bart; De Bock, Katrien. Exercise-induced angiogenesis is dependent on metabolically primed ATF3/4(+) endothelial cells. Cell Metabolism. 2021;33(9):1793-1807.e9.  PubMed
Nie, Huimin; Liu, Boyu; Yin, Chengyu; Chen, Ruixiang; Wang, Jie; Zeng, Danyi; Tai, Yan; Xie, Jingdun; He, Dongwei; Liu, Boyi. Gene Expression Profiling of Contralateral Dorsal Root Ganglia Associated with Mirror-Image Pain in a Rat Model of Complex Regional Pain Syndrome Type-I. Journal Of Pain Research. 14( 34512013):2739-2756.  PubMed
Xie, Guohua; Dong, Ping; Chen, Hui; Xu, Ling; Liu, Yi; Ma, Yanhui; Zheng, Yingxia; Yang, Junyao; Zhou, Yunlan; Chen, Lei; Shen, Lisong. Decreased expression of ATF3, orchestrated by β-catenin/TCF3, miR-17-5p and HOXA11-AS, promoted gastric cancer progression via increased β-catenin and CEMIP. Experimental & Molecular Medicine. 2021;53(11):1706-1722.  PubMed
Xu, Ruoyao; Wang, Jie; Nie, Huimin; Zeng, Danyi; Yin, Chengyu; Li, Yuanyuan; Wei, Huina; Liu, Boyu; Tai, Yan; Hu, Qimiao; Shao, Xiaomei; Fang, Jianqiao; Liu, Boyi. Genome-Wide Expression Profiling by RNA-Sequencing in Spinal Cord Dorsal Horn of a Rat Chronic Postsurgical Pain Model to Explore Potential Mechanisms Involved in Chronic Pain. Journal Of Pain Research. 15( 35411184):985-1001.  PubMed
Wu, Xunwei; Nguyen, Bach-Cuc; Dziunycz, Piotr; Chang, Sungeun; Brooks, Yang; Lefort, Karine; Hofbauer, Günther F L; Dotto, G Paolo. Opposing roles for calcineurin and ATF3 in squamous skin cancer. Nature. 2010;465(7296):368-72.  PubMed
Hai, Tsonwin; Jalgaonkar, Swati; Wolford, Christopher C; Yin, Xin. Immunohistochemical detection of activating transcription factor 3, a hub of the cellular adaptive-response network. Methods In Enzymology. 490( 21266251):175-94.  PubMed
Wei, Saisai; Wang, Hongbo; Lu, Chunwan; Malmut, Sarah; Zhang, Jianqiao; Ren, Shumei; Yu, Guohua; Wang, Wei; Tang, Dale D; Yan, Chunhong. The activating transcription factor 3 protein suppresses the oncogenic function of mutant p53 proteins. The Journal Of Biological Chemistry. 2014;289(13):8947-59.  PubMed
Wang, Tian; Chen, Jeannie. Induction of the unfolded protein response by constitutive G-protein signaling in rod photoreceptor cells. The Journal Of Biological Chemistry. 2014;289(42):29310-21.  PubMed
Inoue, Makoto; Uchida, Yohei; Edagawa, Makoto; Hirata, Manabu; Mitamura, Jun; Miyamoto, Daiki; Taketani, Kenji; Sekine, Shigeki; Kawauchi, Junya; Kitajima, Shigetaka. The stress response gene ATF3 is a direct target of the Wnt/β-catenin pathway and inhibits the invasion and migration of HCT116 human colorectal cancer cells. Plos One. 13(7):e0194160.  PubMed
Gunner, Georgia; Cheadle, Lucas; Johnson, Kasey M; Ayata, Pinar; Badimon, Ana; Mondo, Erica; Nagy, M Aurel; Liu, Liwang; Bemiller, Shane M; Kim, Ki-Wook; Lira, Sergio A; Lamb, Bruce T; Tapper, Andrew R; Ransohoff, Richard M; Greenberg, Michael E; Schaefer, Anne; Schafer, Dorothy P. Sensory lesioning induces microglial synapse elimination via ADAM10 and fractalkine signaling. Nature Neuroscience. 2019;22(7):1075-1088.  PubMed
Wanner, Renate; Knöll, Bernd. Interference with SRF expression in skeletal muscles reduces peripheral nerve regeneration in mice. Scientific Reports. 2020;10(1):5281.  PubMed
Yin, Hui-Min; Yan, Li-Feng; Liu, Qian; Peng, Zheng; Zhang, Chi-Yuan; Xia, Yu; Su, Dan; Gu, Ai-Hua; Zhou, Yong. Activating transcription factor 3 coordinates differentiation of cardiac and hematopoietic progenitors by regulating glucose metabolism. Science Advances. 2020;6(19):eaay9466.  PubMed
Cong, Qifei; Soteros, Breeanne M; Wollet, Mackenna; Kim, Jun Hee; Sia, Gek-Ming. The endogenous neuronal complement inhibitor SRPX2 protects against complement-mediated synapse elimination during development. Nature Neuroscience. 2020;23(9):1067-1078.  PubMed
Li, Yuanyuan; Yin, Chengyu; Liu, Boyu; Nie, Huimin; Wang, Jie; Zeng, Danyi; Chen, Ruixiang; He, Xiaofen; Fang, Junfan; Du, Junying; Liang, Yi; Jiang, Yongliang; Fang, Jianqiao; Liu, Boyi. Transcriptome profiling of long noncoding RNAs and mRNAs in spinal cord of a rat model of paclitaxel-induced peripheral neuropathy identifies potential mechanisms mediating neuroinflammation and pain. Journal Of Neuroinflammation. 2021;18(1):48.  PubMed
Wang, Zhilong; Liu, Yang; Liu, Jingyu; Kong, Na; Jiang, Yue; Jiang, Ruiwei; Zhen, Xin; Zhou, Jidong; Li, Chaojun; Sun, Haixiang; Yan, Guijun. ATF3 deficiency impairs the proliferative-secretory phase transition and decidualization in RIF patients. Cell Death & Disease. 2021;12(4):387.  PubMed
Lu, Ying-Yi; Lu, Chun-Ching; Huang, Chao-Lan; Tsai, Hung-Pei; Wang, Wei-Ting; Zhang, Zi-Hao; Wu, Chieh-Hsin. Linalyl Acetate Ameliorates Mechanical Hyperalgesia Through Suppressing Inflammation by TSLP/IL-33 Signaling. Neurochemical Research. 2022;47(12):3805-3816.  PubMed