Anti APLF pAb (ATL-HPA034643)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034643-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: APLF
Alternative Gene Name: C2orf13, MGC47799, Xip1, ZCCHH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030051: 71%, ENSRNOG00000043059: 74%
Entrez Gene ID: 200558
Uniprot ID: Q8IW19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV |
Gene Sequence | NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV |
Gene ID - Mouse | ENSMUSG00000030051 |
Gene ID - Rat | ENSRNOG00000043059 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APLF pAb (ATL-HPA034643) | |
Datasheet | Anti APLF pAb (ATL-HPA034643) Datasheet (External Link) |
Vendor Page | Anti APLF pAb (ATL-HPA034643) at Atlas Antibodies |
Documents & Links for Anti APLF pAb (ATL-HPA034643) | |
Datasheet | Anti APLF pAb (ATL-HPA034643) Datasheet (External Link) |
Vendor Page | Anti APLF pAb (ATL-HPA034643) |