Anti ACYP2 pAb (ATL-HPA035301 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035301-25

Protein Description: acylphosphatase 2, muscle type
Gene Name: ACYP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060923: 86%, ENSRNOG00000042419: 89%
Entrez Gene ID: 98
Uniprot ID: P14621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNE
• Gene Sequence: EVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNE
• Gene ID - Mouse: ENSMUSG00000060923
• Gene ID - Rat: ENSRNOG00000042419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.